PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS738175.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 214aa    MW: 23693.3 Da    PI: 10.5058
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS738175.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.67.7e-201441155
       G2-like 11 HerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  H++Fv+aveqL G +kA+P +ilelm+ ++L +++++SHLQkYR+
  EcS738175.10  1 HRKFVQAVEQL-GVDKAVPTRILELMGNDSLNRHNIASHLQKYRS 44
                  9**********.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.766147IPR017930Myb domain
TIGRFAMsTIGR015574.8E-18145IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-18148IPR009057Homeodomain-like
SuperFamilySSF466892.15E-11147IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
HRKFVQAVEQ LGVDKAVPTR ILELMGNDSL NRHNIASHLQ KYRSQRRHLQ SLEADAARWS  60
KRRQIYSGAA AAGGGSKRVM TPWAAPAMGF PSAPPSVHHF RPLHVWGHPT LSPSLKHGAW  120
PLHSQPSLVP SPLPTWVPPP LLEHPPPPPP LPPPDPSYWH QQVSIGHPPE FHVISYISSS  180
DLARIRNNLG LSLLACHGHI LVFQAIDILV EILV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035797.11e-110PREDICTED: transcription activator GLK2-like
SwissprotQ5Z5I45e-40GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLA0A059A0K21e-110A0A059A0K2_EUCGR; Uncharacterized protein
STRINGGLYMA12G33430.11e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-35GOLDEN2-like 2